SFXN3 (NM_030971) Human Mass Spec Standard

SKU
PH300974
SFXN3 MS Standard C13 and N15-labeled recombinant protein (NP_112233)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200974]
Predicted MW 36 kDa
Protein Sequence
Protein Sequence
>RC200974 protein sequence
Red=Cloning site Green=Tags(s)

MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQ
LWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRS
GDTPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPV
ADEAGQRLGYSVTAAKQGIFQVVISRICMAIPAMAIPPLIMDTLEKKDFLKRRPWLGAPLQVGLVGFCLV
FATPLCCALFPQKSSIHISNLEPELRAQIHEQNPSVEVVYYNKGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112233
RefSeq Size 3129
RefSeq ORF 975
Synonyms BA108L7.2; SFX3; SLC56A3
Locus ID 81855
UniProt ID Q9BWM7
Cytogenetics 10q24.31
Summary Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway (PubMed:30442778). Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors (PubMed:30442778).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SFXN3 (NM_030971) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410634 SFXN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410634 Transient overexpression lysate of sideroflexin 3 (SFXN3) 100 ug
$436.00
TP300974 Recombinant protein of human sideroflexin 3 (SFXN3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.