SFXN3 Rabbit Polyclonal Antibody

SKU TA339575

Rabbit Polyclonal Anti-SFXN3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SFXN3 antibody: synthetic peptide directed towards the middle region of human SFXN3. Synthetic peptide located within the following region: TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: sideroflexin 3
• Database Link:
  NP_112233
  Q9BWM7
• Background: SFXN3 is a potential iron transporter.
• Synonyms: BA108L7.2; SFX3
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane