OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DARPP32 (PPP1R1B) (NM_181505) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300916
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA312428 Rabbit polyclonal anti-DARPP-32 antibody
100 ul
$380.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DARPP32 or NM_181505"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200916 protein sequence
Red=Cloning site Green=Tags(s)

MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEED
ELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDG
GSEDQVEDPALSEPGEEPQRPSPSEPGT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_852606
Locus ID 84152
UniProt ID Q9UD71
Cytogenetics 17q12
RefSeq Size 1530
RefSeq ORF 504
Synonyms DARPP-32; DARPP32
Summary This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2011
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DARPP32" proteins (7)
SKU Description Size Price
PH300916 PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_852606) 10 ug
$3,360.00
PH312689 PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_115568) 10 ug
$3,360.00
LC403149 Lyophilized PPP1R1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405677 Lyophilized PPP1R1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403149 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY405677 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP312689 Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products