OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DARPP32 (PPP1R1B) (NM_181505) Human Mass Spec Standard

Be the first to review this product
SKU
PH300916
PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_852606)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA312428 Rabbit polyclonal anti-DARPP-32 antibody
100 ul
$380.00
LY405677 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "DARPP32 or NM_181505"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200916
Predicted MW 18.7 kDa
Protein Sequence
Protein Sequence
>RC200916 protein sequence
Red=Cloning site Green=Tags(s)

MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEED
ELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDG
GSEDQVEDPALSEPGEEPQRPSPSEPGT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_852606
RefSeq Size 1530
RefSeq ORF 504
Synonyms DARPP-32; DARPP32
Locus ID 84152
UniProt ID Q9UD71
Cytogenetics 17q12
Summary This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DARPP32" proteins (7)
SKU Description Size Price
PH312689 PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_115568) 10 ug
$3,360.00
LC403149 Lyophilized PPP1R1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405677 Lyophilized PPP1R1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403149 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY405677 Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300916 Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 2, 20 µg 20 ug
$867.00
TP312689 Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products