KCTD15 (NM_024076) Human Recombinant Protein
CAT#: TP300838
Recombinant protein of human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200838 protein sequence
Red=Cloning site Green=Tags(s) MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSS LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN QDPTHVIRFPLNGYCRLNSVQDVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076981 |
Locus ID | 79047 |
UniProt ID | Q96SI1 |
Cytogenetics | 19q13.11 |
Refseq Size | 4935 |
Refseq ORF | 702 |
Summary | During embryonic development, interferes with neural crest formation (By similarity). Inhibits AP2 transcriptional activity by interaction with its activation domain.[UniProtKB/Swiss-Prot Function] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411332 | KCTD15 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411332 | Transient overexpression lysate of potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1 |
USD 436.00 |
|
PH300838 | KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_076981) |
USD 3,255.00 |
|
PH325391 | KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_001123466) |
USD 3,255.00 |
|
TP325391 | Purified recombinant protein of Homo sapiens potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review