KCTD15 (NM_024076) Human Mass Spec Standard

SKU
PH300838
KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_076981)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200838]
Predicted MW 26.5 kDa
Protein Sequence
Protein Sequence
>RC200838 protein sequence
Red=Cloning site Green=Tags(s)

MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSS
LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY
YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN
QDPTHVIRFPLNGYCRLNSVQDVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076981
RefSeq Size 4935
RefSeq ORF 702
Locus ID 79047
UniProt ID Q96SI1
Cytogenetics 19q13.11
Summary During embryonic development, interferes with neural crest formation (By similarity). Inhibits AP2 transcriptional activity by interaction with its activation domain.[UniProtKB/Swiss-Prot Function]
Protein Families Ion Channels: Other
Write Your Own Review
You're reviewing:KCTD15 (NM_024076) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325391 KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_001123466) 10 ug
$3,255.00
LC411332 KCTD15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411332 Transient overexpression lysate of potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1 100 ug
$436.00
TP300838 Recombinant protein of human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325391 Purified recombinant protein of Homo sapiens potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.