KCTD15 (NM_024076) Human Tagged ORF Clone

SKU
RC200838
KCTD15 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KCTD15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200838 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCACCGCAAGGAGCGGCCGAGCGGGTCCTCGCTTCACACACACGGCAGCACCGGCACCGCGGAGG
GAGGAAACATGTCCCGGCTGTCTCTCACCCGGTCGCCTGTGTCTCCCCTGGCTGCCCAGGGCATCCCCCT
GCCAGCCCAGCTCACCAAGTCCAATGCACCTGTGCACATCGATGTGGGCAGCCACATGTACACCAGCAGC
CTGGCCACGCTCACCAAGTACCCTGACTCCAGGATAAGCCGCCTCTTCAATGGCACTGAACCCATCGTCC
TGGACAGTTTGAAGCAACATTATTTCATTGACCGGGATGGGGAGATTTTCCGCTACGTCCTGAGCTTCCT
GCGGACGTCCAAGCTGCTGCTTCCGGATGACTTTAAGGACTTCAGTCTGCTGTACGAGGAGGCGCGCTAC
TATCAGCTCCAGCCCATGGTGCGCGAGCTGGAGCGCTGGCAGCAGGAGCAGGAGCAGCGGCGCCGCAGCC
GGGCCTGTGACTGCCTGGTGGTGCGCGTCACGCCCGACTTGGGCGAGCGGATCGCACTCAGCGGCGAGAA
GGCCCTCATCGAGGAGGTCTTCCCCGAGACCGGAGACGTCATGTGCAACTCCGTCAACGCCGGCTGGAAC
CAGGACCCCACGCACGTCATCCGCTTCCCGCTCAATGGCTACTGCCGGCTCAACTCGGTACAGGATGTTC
TA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200838 protein sequence
Red=Cloning site Green=Tags(s)

MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSS
LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY
YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN
QDPTHVIRFPLNGYCRLNSVQDVL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024076
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024076.1, NP_076981.1
RefSeq Size 4935 bp
RefSeq ORF 705 bp
Locus ID 79047
UniProt ID Q96SI1
Cytogenetics 19q13.11
Domains BTB, K_tetra
Protein Families Ion Channels: Other
MW 26.5 kDa
Summary During embryonic development, interferes with neural crest formation (By similarity). Inhibits AP2 transcriptional activity by interaction with its activation domain.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:KCTD15 (NM_024076) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200838L3 Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200838L4 Lenti ORF clone of Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, mGFP tagged 10 ug
$600.00
RG200838 KCTD15 (tGFP-tagged) - Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319396 KCTD15 (untagged)-Human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.