RRM1 (NM_001033) Human Recombinant Protein

CAT#: TP300726

Recombinant protein of human ribonucleotide reductase M1 (RRM1), 20 µg

Product Images

Afatinib, a covalent inhibitor of ErbB family, modifies RRM1 and RRM2. Two ug recombinant RRM1 (OriGene TP300726) and/or 1 ug RRM2 in the presence of 12.5 uM afatinib were incubated for one hour at 37 C. The reaction product was examined by Coomassie blue G-250 staining and immunoblotting with anti-afatinib antiserum. Figure cited from Oncotarget, PMID: 29765556

• 

  Coomassie blue staining of purified RRM1 protein (Cat# TP300726). The protein was produced from HEK293T cells transfected with RRM1 cDNA clone (Cat# RC200726) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC200726
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTT
  KHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYD
  RDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFN
  AGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPML
  RVYNNTARYVDQGGNKRPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETN
  QDWSLMCPNECPGLDEVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRK
  SNQQNLGTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKIIDI
  NYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGP
  YETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYT
  SNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKT
  VLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKD
  KEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
  myc-FLAG tag
  
  Recombinant protein using RC200726 also available, TP300726
• Tag: C-Myc/DDK
• Predicted MW: 89.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Binding assay (PMID: 29765556)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001024
• Locus ID: 6240
• UniProt ID: P23921
• Cytogenetics: 11p15.4
• Refseq Size: 3117
• Refseq ORF: 2376
• Synonyms: R1; RIR1; RR1
• Summary: This gene encodes the large and catalytic subunit of ribonucleotide reductase, an enzyme essential for the conversion of ribonucleotides into deoxyribonucleotides. A pool of available deoxyribonucleotides is important for DNA replication during S phase of the cell cycle as well as multiple DNA repair processes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome
• Protein Pathways: Glutathione metabolism, Metabolic pathways, Purine metabolism, Pyrimidine metabolism