DDOST (NM_005216) Human Recombinant Protein

CAT#: TP300672M

Recombinant protein of human dolichyl-diphosphooligosaccharide-protein glycosyltransferase (DDOST), 100 µg

Product Images

Coomassie blue staining of purified DDOST protein (Cat# TP300672). The protein was produced from HEK293T cells transfected with DDOST cDNA clone (Cat# RC200672) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200672 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETHSLFFRSLKDR
  GFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRE
  LGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPL
  VLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGS
  QRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDG
  DDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYER
  FIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 46.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005207
• Locus ID: 1650
• UniProt ID: P39656, A0A024RAD5
• Cytogenetics: 1p36.12
• Refseq Size: 2144
• Refseq ORF: 1368
• Synonyms: AGER1; CDG1R; GATD6; OKSWcl45; OST; OST48; WBP1
• Summary: This gene encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-purifies with ribosomes. The product of this gene is also implicated in the processing of advanced glycation endproducts (AGEs), which form from non-enzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, N-Glycan biosynthesis