OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FSTL1 (NM_007085) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300586
Recombinant protein of human follistatin-like 1 (FSTL1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FSTL1 or NM_007085"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200586 protein sequence
Red=Cloning site Green=Tags(s)

MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG
KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS
KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD
WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE
EEMTRYVQELQKHQETAEKTKRVSTKEI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_009016
Locus ID 11167
UniProt ID Q12841
Cytogenetics 3q13.33
RefSeq Size 3840
RefSeq ORF 924
Synonyms FRP; FSL1; MIR198; OCC-1; OCC1; tsc36
Summary This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FSTL1" proteins (6)
SKU Description Size Price
PH300586 FSTL1 MS Standard C13 and N15-labeled recombinant protein (NP_009016) 10 ug
$3,360.00
LC402088 Lyophilized FSTL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402088 Transient overexpression lysate of follistatin-like 1 (FSTL1) (as WB positive control) 100 ug
$436.00
TP720885 Purified recombinant protein of Human follistatin-like 1 (FSTL1) 10 ug
$275.00
TP721119 Purified recombinant protein of Human follistatin-like 1 (FSTL1) 10 ug
$260.00
TP721135 Purified recombinant protein of Human follistatin-like 1 (FSTL1) 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products