FSTL1 (NM_007085) Human Mass Spec Standard

SKU
PH300586
FSTL1 MS Standard C13 and N15-labeled recombinant protein (NP_009016)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200586]
Predicted MW 35 kDa
Protein Sequence
Protein Sequence
>RC200586 protein sequence
Red=Cloning site Green=Tags(s)

MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG
KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS
KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD
WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE
EEMTRYVQELQKHQETAEKTKRVSTKEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009016
RefSeq Size 3840
RefSeq ORF 924
Synonyms FRP; FSL1; MIR198; OCC-1; OCC1; tsc36
Locus ID 11167
UniProt ID Q12841
Cytogenetics 3q13.33
Summary This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:FSTL1 (NM_007085) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402088 FSTL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402088 Transient overexpression lysate of follistatin-like 1 (FSTL1) 100 ug
$436.00
TP300586 Recombinant protein of human follistatin-like 1 (FSTL1), 20 µg 20 ug
$867.00
TP720885 Purified recombinant protein of Human follistatin-like 1 (FSTL1) 10 ug
$265.00
TP721119 Purified recombinant protein of Human follistatin-like 1 (FSTL1) 10 ug
$250.00
TP721135 Purified recombinant protein of Human follistatin-like 1 (FSTL1) 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.