FSTL1 (NM_007085) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC200586] |
Predicted MW | 35 kDa |
Protein Sequence |
Protein Sequence
>RC200586 protein sequence
Red=Cloning site Green=Tags(s) MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE EEMTRYVQELQKHQETAEKTKRVSTKEI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_009016 |
RefSeq Size | 3840 |
RefSeq ORF | 924 |
Synonyms | FRP; FSL1; MIR198; OCC-1; OCC1; tsc36 |
Locus ID | 11167 |
UniProt ID | Q12841 |
Cytogenetics | 3q13.33 |
Summary | This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC402088 | FSTL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402088 | Transient overexpression lysate of follistatin-like 1 (FSTL1) | 100 ug |
$436.00
|
|
TP300586 | Recombinant protein of human follistatin-like 1 (FSTL1), 20 µg | 20 ug |
$867.00
|
|
TP720885 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) | 10 ug |
$265.00
|
|
TP721119 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) | 10 ug |
$250.00
|
|
TP721135 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) | 10 ug |
$250.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.