FSTL1 (NM_007085) Human Recombinant Protein

SKU
TP300586
Recombinant protein of human follistatin-like 1 (FSTL1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200586 protein sequence
Red=Cloning site Green=Tags(s)

MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG
KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS
KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD
WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE
EEMTRYVQELQKHQETAEKTKRVSTKEI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_009016
Locus ID 11167
UniProt ID Q12841
Cytogenetics 3q13.33
RefSeq Size 3840
RefSeq ORF 924
Synonyms FRP; FSL1; MIR198; OCC-1; OCC1; tsc36
Summary This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:FSTL1 (NM_007085) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300586 FSTL1 MS Standard C13 and N15-labeled recombinant protein (NP_009016) 10 ug
$3,255.00
LC402088 FSTL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402088 Transient overexpression lysate of follistatin-like 1 (FSTL1) 100 ug
$436.00
TP720885 Purified recombinant protein of Human follistatin-like 1 (FSTL1) 10 ug
$265.00
TP721119 Purified recombinant protein of Human follistatin-like 1 (FSTL1) 10 ug
$250.00
TP721135 Purified recombinant protein of Human follistatin-like 1 (FSTL1) 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.