OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

S100 beta (S100B) (NM_006272) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300277
Recombinant protein of human S100 calcium binding protein B (S100B), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA700560 S100B Biotinylated Detection Mouse Monoclonal antibody, clone OTI3G6 50 ug
$494.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "S100 beta or NM_006272"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200277 protein sequence
Red=Cloning site Green=Tags(s)

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECD
FQEFMAFVAMVTTACHEFFEHE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 10.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006263
Locus ID 6285
UniProt ID P04271
Cytogenetics 21q22.3
RefSeq Size 1135
RefSeq ORF 276
Synonyms NEF; S100; S100-B; S100beta
Summary The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "S100 beta" proteins (4)
SKU Description Size Price
PH300277 S100B MS Standard C13 and N15-labeled recombinant protein (NP_006263) 10 ug
$3,360.00
LC416735 Lyophilized S100B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416735 Transient overexpression lysate of S100 calcium binding protein B (S100B) (as WB positive control) 100 ug
$436.00
TP750189 Purified recombinant protein of Human S100 calcium binding protein B (S100B),full length, tag free, expressed in E.coli, 50ug 50 ug
$380.00

file-alt Citations

Catch-and-display immunoassay for digital biomarker detection
Liu, Walker, Klaczko et al
Nanoscale Horiz (2026)
AI Summary: OriGene contributed key reagents to this study by providing anti-S100B antibodies (TA700560 and TA600560), anti-GFAP antibody pairs (TA700041 and TA600039), and S100B protein (TP300277), which were essential for developing and validating the Catch-and-Display Immunoassay (CAD-IA) described in the paper.
Snippet: The following reagents and materials were used in this study: anti-S100B (TA700560 and TA600560), anti-GFAP antibody pairs (TA700041 and TA600039), and S100B (TP300277) were all purchased from Origene
Catch-and-Display Immunoassay as an Accessible Platform for Digital Biomarker Detection
Liu, Walker, Klaczko et al
bioRxiv (2026)
AI Summary: OriGene contributed to this study by providing antibody pairs (TA700041 and TA600039) and the S100B protein (TP300277), which were essential reagents for developing and validating the Catch-and-Display Immunoassay platform.
Snippet: body pairs (TA700041 and TA600039), and S100B (TP300277) were all purchased from Origene. GFAP was purchased from Cayman Chemical Company (27353). Non-PEGylated Dragon Green Fluorescent Polystyrene Nanoparticles (200 nm, Streptavidin-Coated, Ext480/Emi520) were obtained from Bangslaboratory (FSDG002). PEGylated DiagNano
A multimodal RAGE-specific inhibitor reduces amyloid β-mediated brain disorder in a mouse model of Alzheimer disease
Deane, Singh, Sagare et al
J. Clin. Invest. (2012) 122 (4), 1377-92 DOI: 10.1172/JCI58642
Cited by 41
AI Summary: In this study, OriGene's RAGE expression plasmid (Cat# RC210438) was used to generate RAGE-expressing cells for in vitro experiments assessing the inhibitory effects of FPS-ZM1 on amyloid β-induced cellular stress.
Snippet: RAGE contains an extracellular V domain that binds multiple ligands, including advanced glycation end products (AGE) proteins, S100/calgranulins, Aβ and amphoterin, 2 C-type immunoglobulin domains, and a short cytoplasmic domain that is required for RAGE-mediated
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products