OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

S100 beta (S100B) (NM_006272) Human Mass Spec Standard

Be the first to review this product
SKU
PH300277
S100B MS Standard C13 and N15-labeled recombinant protein (NP_006263)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA700560 S100B Biotinylated Detection Mouse Monoclonal antibody, clone OTI3G6 50 ug
$494.00
LY416735 Transient overexpression lysate of S100 calcium binding protein B (S100B) (as WB positive control) 100 ug
$436.00

Other products for "S100 beta or NM_006272"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200277
Predicted MW 10.7 kDa
Protein Sequence
Protein Sequence
>RC200277 protein sequence
Red=Cloning site Green=Tags(s)

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECD
FQEFMAFVAMVTTACHEFFEHE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006263
RefSeq Size 1135
RefSeq ORF 276
Synonyms NEF; S100; S100-B; S100beta
Locus ID 6285
UniProt ID P04271
Cytogenetics 21q22.3
Summary The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "S100 beta" proteins (4)
SKU Description Size Price
LC416735 Lyophilized S100B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416735 Transient overexpression lysate of S100 calcium binding protein B (S100B) (as WB positive control) 100 ug
$436.00
TP300277 Recombinant protein of human S100 calcium binding protein B (S100B), 20 µg 20 ug
$737.00
TP750189 Purified recombinant protein of Human S100 calcium binding protein B (S100B),full length, tag free, expressed in E.coli, 50ug 50 ug
$380.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products