OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDAP1 (NM_014891) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300058
Recombinant protein of human PDGFA associated protein 1 (PDAP1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PDAP1 or NM_014891"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200058 protein sequence
Red=Cloning site Green=Tags(s)

MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDY
QQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADL
ARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055706
Locus ID 11333
UniProt ID Q13442
Cytogenetics 7q22.1
RefSeq Size 2707
RefSeq ORF 543
Synonyms HASPP28; PAP; PAP1
Summary The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. provided by RefSeq, Dec 2010
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDAP1" proteins (4)
SKU Description Size Price
PH300058 PDAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055706) 10 ug
$3,360.00
LC402386 Lyophilized PDAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402386 Transient overexpression lysate of PDGFA associated protein 1 (PDAP1) (as WB positive control) 100 ug
$436.00
TP720268 Recombinant protein of human PDGFA associated protein 1 (PDAP1) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products