OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDAP1 (NM_014891) Human Mass Spec Standard

Be the first to review this product
SKU
PH300058
PDAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055706)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY402386 Transient overexpression lysate of PDGFA associated protein 1 (PDAP1) (as WB positive control) 100 ug
$436.00

Other products for "PDAP1 or NM_014891"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200058
Predicted MW 20.6 kDa
Protein Sequence
Protein Sequence
>RC200058 protein sequence
Red=Cloning site Green=Tags(s)

MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDY
QQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADL
ARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055706
RefSeq Size 2707
RefSeq ORF 543
Synonyms HASPP28; PAP; PAP1
Locus ID 11333
UniProt ID Q13442
Cytogenetics 7q22.1
Summary The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. provided by RefSeq, Dec 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDAP1" proteins (4)
SKU Description Size Price
LC402386 Lyophilized PDAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402386 Transient overexpression lysate of PDGFA associated protein 1 (PDAP1) (as WB positive control) 100 ug
$436.00
TP300058 Recombinant protein of human PDGFA associated protein 1 (PDAP1), 20 µg 20 ug
$867.00
TP720268 Recombinant protein of human PDGFA associated protein 1 (PDAP1) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products