OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDAP1 (NM_014891) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200058
PDAP1 (Myc-DDK-tagged)-Human PDGFA associated protein 1 (PDAP1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PDAP1 or NM_014891"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PDAP1
Synonyms HASPP28; PAP; PAP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200058 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTAAAGGAGGAAGAAAGGGAGGCCACAAAGGCCGGGCGAGGCAGTATACAAGCCCTGAGGAGATCG
ACGCGCAGCTGCAGGCTGAGAAGCAGAAGGCCAGGGAAGAAGAGGAGCAAAAAGAAGGTGGAGATGGGGC
TGCAGGTGACCCCAAAAAGGAGAAGAAATCTCTAGACTCAGATGAGAGTGAGGATGAAGAAGATGACTAC
CAGCAAAAGCGCAAAGGCGTTGAAGGGCTCATCGACATCGAGAACCCCAACCGGGTGGCACAGACAACCA
AAAAGGTCACACAACTGGATCTGGACGGGCCAAAGGAGCTTTCGAGGAGAGAACGAGAAGAGATTGAGAA
GCAGAAGGCAAAAGAGCGTTACATGAAAATGCACTTGGCCGGGAAGACAGAGCAAGCCAAGGCTGACCTG
GCCCGGCTGGCCATCATCCGGAAACAGCGGGAGGAGGCTGCCCGGAAGAAGGAAGAGGAAAGGAAAGCAA
AAGACGATGCCACATTGTCAGGAAAACGAATGCAGTCACTCTCCCTGAATAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200058 protein sequence
Red=Cloning site Green=Tags(s)

MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDY
QQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADL
ARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014891
ORF Size 543 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014891.7
RefSeq Size 2707 bp
RefSeq ORF 546 bp
Locus ID 11333
UniProt ID Q13442
Cytogenetics 7q22.1
MW 20.6 kDa
Summary The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. provided by RefSeq, Dec 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014891" in other vectors (4)
SKU Description Size Price
RC200058L3 Lenti ORF clone of Human PDGFA associated protein 1 (PDAP1), Myc-DDK-tagged 10 ug
$600.00
RC200058L4 Lenti ORF clone of Human PDGFA associated protein 1 (PDAP1), mGFP tagged 10 ug
$600.00
RG200058 PDAP1 (tGFP-tagged) - Human PDGFA associated protein 1 (PDAP1) 10 ug
$489.00 $500.00
SC114739 PDAP1 (untagged)-Human PDGFA associated protein 1 (PDAP1) 10 ug
$300.00

Plasmid Map for RC200058

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200058
Circular map for RC200058

file-alt Citations

Hepatovirus translation requires PDGFA-associated protein 1, an eIF4E-binding protein regulating endoplasmic reticulum stress responses
Shirasaki, Lenarcic, Misumi et al
Sci Adv (2024) 10 (47), eadq6342 DOI: 10.1126/sciadv.adq6342
Cited by 9
AI Summary: OriGene contributed to this study by providing the pPDAP1-Flag plasmid (pRC20058), which encodes C-terminal Myc/Flag-tagged human PDAP1 and was used to investigate the role of PDAP1 in hepatovirus translation and ER stress responses.
Snippet: porter pFL-HAV-RL (58) have been described previously. pPDAP1-Flag, encoding C-terminal Myc/Flag-tagged human PDAP1 (NM_014891.7) under the control of the cytomegalovirus promoter, was purchased from Origene (pRC20058). pPDAP1-Y124 was generated from pPDAP1-Flag by PCR mutagenesis. pMCSG9-PDAP1-Avi, a bacterial expression vector encoding maltose-binding protein fused to PDAP1 with an intervening t
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products