OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EBF4 (NM_001110514) Human Mass Spec Standard

Be the first to review this product
SKU
PH326006
EBF4 MS Standard C13 and N15-labeled recombinant protein (NP_001103984)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA332196 Rabbit Polyclonal Anti-EBF4 Antibody
100 ul
$575.00
LY426327 Transient overexpression lysate of early B-cell factor 4 (EBF4) (as WB positive control) 100 ug
$436.00

Other products for "EBF4 or NM_001110514"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226006
Predicted MW 63.8 kDa
Protein Sequence
Protein Sequence
>RC226006 representing NM_001110514
Red=Cloning site Green=Tags(s)

MDALPRSGLNLKEEPLLPAGLGSVRSWMQGAGILDASTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLA
MYDRQGQPVEVERTAFIDFVEKDREPGAEKTNNGIHYRLRLVYNNGLRTEQDLYVRLIDSMSKQAIIYEG
QDKNPEMCRVLLTHEIMCSRCCDRKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQV
VVSTTVSVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEAATPCIKAISPGEGWTTGGATVIVIGDNFFDG
LQVVFGNVLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGCPGRFVYTALNEPTIDYGFQRLQ
KVIPRHPGDPERLPKEVLLKRAADLAEALYGVPGSNQELLLKRAADVAEALYSTPRAPGPLAPLAPSHPH
PAVVGINAFSSPLAIAVGDATPGPEPGYARSCSSASPRGFAPSPGSQQSGYGGGLGAGLGGYGAPGVAGL
GVPGSPSFLNGSTATSPFAIMPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPS
SPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001103984
RefSeq ORF 1794
Synonyms COE4; O/E-4
Locus ID 57593
UniProt ID Q9BQW3
Cytogenetics 20p13
Summary EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play important roles in neural development and B-cell maturation (Wang et al., 2002 PubMed 12139918).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EBF4" proteins (6)
SKU Description Size Price
LC412258 Lyophilized EBF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426327 Lyophilized EBF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412258 Transient overexpression lysate of early B-cell factor 4 (EBF4) (as WB positive control) 100 ug
$665.00
LY426327 Transient overexpression lysate of early B-cell factor 4 (EBF4) (as WB positive control) 100 ug
$436.00
TP315467 Purified recombinant protein of Homo sapiens early B-cell factor 4 (EBF4), 20 µg 20 ug
$867.00
TP326006 Recombinant protein of human early B-cell factor 4 (EBF4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products