OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CSNK1G3 (NM_001044723) Human Mass Spec Standard

Be the first to review this product
SKU
PH322230
CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_001038188)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340050 Rabbit Polyclonal Anti-CSNK1G3 Antibody
100 ul
$585.00
LY420831 Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "CSNK1G3 or NM_001044723"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222230
Predicted MW 52.2 kDa
Protein Sequence
Protein Sequence
>RC222230 representing NM_001044723
Red=Cloning site Green=Tags(s)

MENKKKDKDKSDDRMARPSGRSGHNTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVA
IKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVL
MIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLT
GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENF
PEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAH
QHRDKMQQSKNQSADHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSSTNGELNTDDPTAGRSNAPITAP
TEVEVMDETNCQKVLNMWCCCFFKRRKRKTIQRHK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001038188
RefSeq Size 4462
RefSeq ORF 1365
Synonyms CKI-gamma 3; CSNK1G3L
Locus ID 1456
UniProt ID Q9Y6M4
Cytogenetics 5q23.2
Summary This gene encodes a member of a family of serine/threonine protein kinases that phosphorylate caseins and other acidic proteins. A related protein in the African clawed frog participates in the transmission of Wnt/beta-catenin signaling. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Jul 2012
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Hedgehog signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CSNK1G3" proteins (13)
SKU Description Size Price
PH307965 CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_001026982) 10 ug
$3,360.00
PH322490 CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_004375) 10 ug
$3,360.00
LC401396 Lyophilized CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420831 Lyophilized CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420832 Lyophilized CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422199 Lyophilized CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401396 Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY420831 Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY420832 Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY422199 Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307965 Recombinant protein of human casein kinase 1, gamma 3 (CSNK1G3), transcript variant 2, 20 µg 20 ug
$737.00
TP322230 Purified recombinant protein of Homo sapiens casein kinase 1, gamma 3 (CSNK1G3), transcript variant 4, 20 µg 20 ug
$737.00
TP322490 Recombinant protein of human casein kinase 1, gamma 3 (CSNK1G3), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products