CSNK1G3 Rabbit Polyclonal Antibody

SKU TA340050

Rabbit Polyclonal Anti-CSNK1G3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSNK1G3 antibody: synthetic peptide directed towards the middle region of human CSNK1G3. Synthetic peptide located within the following region: LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: casein kinase 1 gamma 3
• Database Link:
  NP_001038187
  Q9Y6M4
• Background: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1G3 can phosphorylate a large number of proteins. It participates in Wnt signaling.
• Synonyms: casein kinase 1; gamma 3; OTTHUMP00000159174; OTTHUMP00000159175
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Hedgehog signaling pathway