CSNK1G3 (NM_001031812) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC207965] |
Predicted MW | 48.9 kDa |
Protein Sequence |
Protein Sequence
>RC207965 protein sequence
Red=Cloning site Green=Tags(s) MENKKKDKDKSDDRMARPSGRSGHNTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVA IKLEPMKSRAPQLHLEYRFYEQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVL MIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLT GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENF PEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAH QHRDKMQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETNCQKVLNMWCCCFFKRRKRKTIQ RHK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001026982 |
RefSeq Size | 4651 |
RefSeq ORF | 1269 |
Synonyms | CKI-gamma 3; CSNK1G3L |
Locus ID | 1456 |
UniProt ID | Q9Y6M4 |
Cytogenetics | 5q23.2 |
Summary | This gene encodes a member of a family of serine/threonine protein kinases that phosphorylate caseins and other acidic proteins. A related protein in the African clawed frog participates in the transmission of Wnt/beta-catenin signaling. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Hedgehog signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH322230 | CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_001038188) | 10 ug |
$3,255.00
|
|
PH322490 | CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_004375) | 10 ug |
$3,255.00
|
|
LC401396 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420831 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420832 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422199 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401396 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 1 | 100 ug |
$665.00
|
|
LY420831 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 3 | 100 ug |
$436.00
|
|
LY420832 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 4 | 100 ug |
$665.00
|
|
LY422199 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 2 | 100 ug |
$436.00
|
|
TP307965 | Recombinant protein of human casein kinase 1, gamma 3 (CSNK1G3), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP322230 | Purified recombinant protein of Homo sapiens casein kinase 1, gamma 3 (CSNK1G3), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP322490 | Recombinant protein of human casein kinase 1, gamma 3 (CSNK1G3), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.