CSNK1G3 (NM_004384) Human Mass Spec Standard

SKU
PH322490
CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_004375)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222490]
Predicted MW 47.92 kDa
Protein Sequence
Protein Sequence
>RC222490 representing NM_004384
Red=Cloning site Green=Tags(s)

MENKKKDKDKSDDRMARPSGRSGHNTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVA
IKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVL
MIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFALAKEYIDPETKKHIPYREHKSLT
GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENF
PEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAH
QHRDKMQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETKCCCFFKRRKRKTIQRHK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004375
RefSeq Size 4352
RefSeq ORF 1245
Synonyms CKI-gamma 3; CSNK1G3L
Locus ID 1456
UniProt ID Q9Y6M4
Cytogenetics 5q23.2
Summary This gene encodes a member of a family of serine/threonine protein kinases that phosphorylate caseins and other acidic proteins. A related protein in the African clawed frog participates in the transmission of Wnt/beta-catenin signaling. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Hedgehog signaling pathway
Write Your Own Review
You're reviewing:CSNK1G3 (NM_004384) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307965 CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_001026982) 10 ug
$3,255.00
PH322230 CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_001038188) 10 ug
$3,255.00
LC401396 CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420831 CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420832 CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422199 CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401396 Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 1 100 ug
$665.00
LY420831 Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 3 100 ug
$436.00
LY420832 Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 4 100 ug
$665.00
LY422199 Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 2 100 ug
$436.00
TP307965 Recombinant protein of human casein kinase 1, gamma 3 (CSNK1G3), transcript variant 2, 20 µg 20 ug
$737.00
TP322230 Purified recombinant protein of Homo sapiens casein kinase 1, gamma 3 (CSNK1G3), transcript variant 4, 20 µg 20 ug
$737.00
TP322490 Recombinant protein of human casein kinase 1, gamma 3 (CSNK1G3), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.