OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NEDD4 (NM_006154) Human Mass Spec Standard

Be the first to review this product
SKU
PH321706
NEDD4 MS Standard C13 and N15-labeled recombinant protein (NP_006145)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA812642 NEDD4 mouse monoclonal antibody,clone OTI5A8 100 ul
$447.00
LY416833 Transient overexpression lysate of neural precursor cell expressed, developmentally down-regulated 4 (NEDD4), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "NEDD4 or NM_006154"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221706
Predicted MW 104 kDa
Protein Sequence
Protein Sequence
>RC221706 representing NM_006154
Red=Cloning site Green=Tags(s)

MATCAVEVFGLLEDEENSRIVRVRVIAGIGLAKKDILGASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNP
KWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRV
KGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAACHLQQQQEPSPLPPGWEERQDILGRTYYV
NHESRRTQWKRPTPQDNLTDAENGNIQLQAQRAFTTRRQISEETESVDNQESSENWEIIREDEATMYSSQ
AFPSPPPSSNLDVPTHLAEELNARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGL
PPGWEEKQDERGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEERTHTDGRIF
YINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVLEDSYRRI
MGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNED
HLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRF
IIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDE
NELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAE
LYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006145
RefSeq Size 5749
RefSeq ORF 2700
Synonyms NEDD4-1; RPF1
Locus ID 4734
UniProt ID P46934
Cytogenetics 15q21.3
Summary This gene is the founding member of the NEDD4 family of HECT ubiquitin ligases that function in the ubiquitin proteasome system of protein degradation. The encoded protein contains an N-terminal calcium and phospholipid binding C2 domain followed by multiple tryptophan-rich WW domains and, a C-terminal HECT ubiquitin ligase catalytic domain. It plays critical role in the regulation of a number of membrane receptors, endocytic machinery components and the tumor suppressor PTEN. provided by RefSeq, Jul 2016
Protein Families Druggable Genome
Protein Pathways Endocytosis, Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NEDD4" proteins (5)
SKU Description Size Price
LC405051 Lyophilized NEDD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416833 Lyophilized NEDD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405051 Transient overexpression lysate of neural precursor cell expressed, developmentally down-regulated 4 (NEDD4), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY416833 Transient overexpression lysate of neural precursor cell expressed, developmentally down-regulated 4 (NEDD4), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP321706 Recombinant protein of human neural precursor cell expressed, developmentally down-regulated 4 (NEDD4), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products