NEDD4 (NM_006154) Human Recombinant Protein

SKU
TP321706
Recombinant protein of human neural precursor cell expressed, developmentally down-regulated 4 (NEDD4), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221706 representing NM_006154
Red=Cloning site Green=Tags(s)

MATCAVEVFGLLEDEENSRIVRVRVIAGIGLAKKDILGASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNP
KWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRV
KGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAACHLQQQQEPSPLPPGWEERQDILGRTYYV
NHESRRTQWKRPTPQDNLTDAENGNIQLQAQRAFTTRRQISEETESVDNQESSENWEIIREDEATMYSSQ
AFPSPPPSSNLDVPTHLAEELNARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGL
PPGWEEKQDERGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEERTHTDGRIF
YINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVLEDSYRRI
MGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNED
HLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRF
IIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDE
NELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAE
LYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 104 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006145
Locus ID 4734
UniProt ID P46934
Cytogenetics 15q21.3
RefSeq Size 5749
RefSeq ORF 2700
Synonyms NEDD4-1; RPF1
Summary This gene is the founding member of the NEDD4 family of HECT ubiquitin ligases that function in the ubiquitin proteasome system of protein degradation. The encoded protein contains an N-terminal calcium and phospholipid binding C2 domain followed by multiple tryptophan-rich WW domains and, a C-terminal HECT ubiquitin ligase catalytic domain. It plays critical role in the regulation of a number of membrane receptors, endocytic machinery components and the tumor suppressor PTEN. [provided by RefSeq, Jul 2016]
Protein Families Druggable Genome
Protein Pathways Endocytosis, Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:NEDD4 (NM_006154) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321706 NEDD4 MS Standard C13 and N15-labeled recombinant protein (NP_006145) 10 ug
$3,255.00
LC405051 NEDD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416833 NEDD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405051 Transient overexpression lysate of neural precursor cell expressed, developmentally down-regulated 4 (NEDD4), transcript variant 2 100 ug
$665.00
LY416833 Transient overexpression lysate of neural precursor cell expressed, developmentally down-regulated 4 (NEDD4), transcript variant 1 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.