OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VAMP1 (NM_014231) Human Mass Spec Standard

Be the first to review this product
SKU
PH320854
VAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_055046)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351909 Rabbit Polyclonal Anti-VAMP1 Antibody
100 ul
$205.00
LY413817 Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "VAMP1 or NM_014231"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220854
Predicted MW 12.7 kDa
Protein Sequence
Protein Sequence
>RC220854 representing NM_014231
Red=Cloning site Green=Tags(s)

MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD
ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055046
RefSeq Size 2748
RefSeq ORF 354
Synonyms CMS25; SPAX1; SYB1; VAMP-1
Locus ID 6843
UniProt ID P23763
Cytogenetics 12p13.31
Summary Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. provided by RefSeq, Jul 2014
Protein Families Secreted Protein, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VAMP1" proteins (7)
SKU Description Size Price
LC404313 Lyophilized VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413817 Lyophilized VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415422 Lyophilized VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404313 Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY413817 Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY415422 Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP320854 Recombinant protein of human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products