VAMP1 (NM_014231) Human Tagged ORF Clone

SKU
RC220854
VAMP1 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol VAMP1
Synonyms CMS25; SPAX1; SYB1; VAMP-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220854 representing NM_014231
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGCTCCAGCTCAGCCACCTGCTGAAGGGACAGAAGGGACTGCCCCAGGTGGGGGTCCCCCTGGCC
CTCCTCCTAACATGACCAGTAACAGACGACTACAGCAAACCCAGGCACAAGTGGAGGAGGTGGTGGACAT
CATACGTGTGAACGTGGACAAGGTCCTGGAGAGGGACCAGAAGCTGTCAGAGCTGGATGACCGAGCTGAT
GCCTTGCAGGCAGGAGCATCACAATTTGAGAGCAGTGCTGCAAAGCTAAAGAGGAAGTATTGGTGGAAAA
ACTGCAAGATGATGATCATGCTGGGAGCCATCTGTGCCATCATCGTGGTAGTTATTGTAATCTACTTTTT
TACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220854 representing NM_014231
Red=Cloning site Green=Tags(s)

MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD
ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014231
ORF Size 354 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014231.5
RefSeq Size 2748 bp
RefSeq ORF 357 bp
Locus ID 6843
UniProt ID P23763
Cytogenetics 12p13.31
Domains synaptobrevin
Protein Families Secreted Protein, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
MW 12.7 kDa
Summary Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:VAMP1 (NM_014231) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220854L1 Lenti ORF clone of Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC220854L2 Lenti ORF clone of Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, mGFP tagged 10 ug
$450.00
RC220854L3 Lenti ORF clone of Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC220854L4 Lenti ORF clone of Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, mGFP tagged 10 ug
$450.00
RG220854 VAMP1 (tGFP-tagged) - Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1 10 ug
$489.00
SC311201 VAMP1 (untagged)-Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.