VAMP1 (NM_014231) Human Recombinant Protein
SKU
TP320854
Recombinant protein of human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC220854 representing NM_014231
Red=Cloning site Green=Tags(s) MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_055046 |
Locus ID | 6843 |
UniProt ID | P23763 |
Cytogenetics | 12p13.31 |
RefSeq Size | 2748 |
RefSeq ORF | 354 |
Synonyms | CMS25; SPAX1; SYB1; VAMP-1 |
Summary | Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014] |
Protein Families | Secreted Protein, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH320854 | VAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_055046) | 10 ug |
$3,255.00
|
|
LC404313 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413817 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC415422 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429412 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404313 | Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 2 | 100 ug |
$436.00
|
|
LY413817 | Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 3 | 100 ug |
$436.00
|
|
LY415422 | Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.