VAMP1 (NM_014231) Human Mass Spec Standard

SKU PH320854

VAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_055046)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC220854]
• Predicted MW: 12.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC220854 representing NM_014231; Red=Cloning site Green=Tags(s); ; MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD; ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_055046
• RefSeq Size: 2748
• RefSeq ORF: 354
• Synonyms: CMS25; SPAX1; SYB1; VAMP-1
• Locus ID: 6843
• UniProt ID: P23763
• Cytogenetics: 12p13.31
• Summary: Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014]
• Protein Families: Secreted Protein, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport