NEU2 (NM_005383) Human Mass Spec Standard

CAT#: PH319858

NEU2 MS Standard C13 and N15-labeled recombinant protein (NP_005374)

Product Images

Coomassie blue staining of purified NEU2 protein (Cat# TP319858). The protein was produced from HEK293T cells transfected with NEU2 cDNA clone (Cat# RC219858) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219858
• Predicted MW: 42.1 kDa
• Protein Sequence:
  Sequence Link

  >RC219858 representing NM_005383
  Red=Cloning site Green=Tags(s)
  
  MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTHQVQWQA
  QEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPR
  DLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGH
  FVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFP
  SPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLF
  GCLYEANDYEEIVFLMFTLKQAFPAEYLPQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005374
• RefSeq Size: 1143
• RefSeq ORF: 1140
• Synonyms: SIAL2
• Locus ID: 4759
• UniProt ID: Q9Y3R4
• Cytogenetics: 2q37.1
• Summary: This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. [provided by RefSeq, Jul 2008]
• Protein Pathways: Other glycan degradation, Sphingolipid metabolism