OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD147 (BSG) (NM_198591) Human Mass Spec Standard

Be the first to review this product
SKU
PH319418
BSG MS Standard C13 and N15-labeled recombinant protein (NP_940993)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501189 BSG (CD147) mouse monoclonal antibody, clone OTI10E10 (formerly 10E10) 100 ul
$447.00
LY403688 Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 4 (as WB positive control) 100 ug
$436.00

Other products for "CD147 or NM_198591"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219418
Predicted MW 22.6 kDa
Protein Sequence
Protein Sequence
>RC219418 representing NM_198591
Red=Cloning site Green=Tags(s)

MKQSDASPQERVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPV
TDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRS
HLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_940993
RefSeq Size 1609
RefSeq ORF 615
Synonyms 5F7; CD147; EMMPRIN; EMPRIN; HAb18G; OK; SLC7A11; TCSF
Locus ID 682
UniProt ID P35613
Cytogenetics 19p13.3
Summary The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, May 2020
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD147" proteins (12)
SKU Description Size Price
PH303894 BSG MS Standard C13 and N15-labeled recombinant protein (NP_940991) 10 ug
$3,360.00
PH319464 BSG MS Standard C13 and N15-labeled recombinant protein (NP_001719) 10 ug
$3,360.00
LC403688 Lyophilized BSG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403695 Lyophilized BSG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419777 Lyophilized BSG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403688 Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY403695 Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419777 Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303894 Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2, 20 µg 20 ug
$737.00
TP319418 Purified recombinant protein of Homo sapiens basigin (Ok blood group) (BSG), transcript variant 4, 20 µg 20 ug
$737.00
TP319464 Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 1, 20 µg 20 ug
$737.00
TP720365 Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products