CD147 (BSG) (NM_198591) Human Recombinant Protein

SKU
TP319418
Purified recombinant protein of Homo sapiens basigin (Ok blood group) (BSG), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219418 representing NM_198591
Red=Cloning site Green=Tags(s)

MKQSDASPQERVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPV
TDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRS
HLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 22.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_940993
Locus ID 682
UniProt ID P35613
Cytogenetics 19p13.3
RefSeq Size 1609
RefSeq ORF 615
Synonyms 5F7; CD147; EMMPRIN; EMPRIN; HAb18G; OK; SLC7A11; TCSF
Summary The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Write Your Own Review
You're reviewing:CD147 (BSG) (NM_198591) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303894 BSG MS Standard C13 and N15-labeled recombinant protein (NP_940991) 10 ug
$3,255.00
PH319418 BSG MS Standard C13 and N15-labeled recombinant protein (NP_940993) 10 ug
$3,255.00
PH319464 BSG MS Standard C13 and N15-labeled recombinant protein (NP_001719) 10 ug
$3,255.00
LC403688 BSG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403695 BSG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419777 BSG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403688 Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 4 100 ug
$436.00
LY403695 Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 2 100 ug
$436.00
LY419777 Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 1 100 ug
$436.00
TP303894 Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2, 20 µg 20 ug
$737.00
TP319464 Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 1, 20 µg 20 ug
$737.00
TP720365 Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.