CD147 (BSG) (NM_001728) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC219464] |
Predicted MW | 42.2 kDa |
Protein Sequence |
Protein Sequence
>RC219464 representing NM_001728
Red=Cloning site Green=Tags(s) MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQL WDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPG TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPM GTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQ GRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRK PEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001719 |
RefSeq Size | 2024 |
RefSeq ORF | 1155 |
Synonyms | 5F7; CD147; EMMPRIN; EMPRIN; HAb18G; OK; TCSF |
Locus ID | 682 |
UniProt ID | P35613 |
Cytogenetics | 19p13.3 |
Summary | The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303894 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_940991) | 10 ug |
$3,255.00
|
|
PH319418 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_940993) | 10 ug |
$3,255.00
|
|
LC403688 | BSG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC403695 | BSG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419777 | BSG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403688 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 4 | 100 ug |
$436.00
|
|
LY403695 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 2 | 100 ug |
$436.00
|
|
LY419777 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 1 | 100 ug |
$436.00
|
|
TP303894 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP319418 | Purified recombinant protein of Homo sapiens basigin (Ok blood group) (BSG), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP319464 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP720365 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2 | 10 ug |
$230.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.