CD147 (BSG) (NM_198589) Human Mass Spec Standard

SKU
PH303894
BSG MS Standard C13 and N15-labeled recombinant protein (NP_940991)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203894]
Predicted MW 29.2 kDa
Protein Sequence
Protein Sequence
>RC203894 protein sequence
Red=Cloning site Green=Tags(s)

MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQ
KTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWY
KITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALW
PFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_940991
RefSeq Size 1759
RefSeq ORF 807
Synonyms 5F7; CD147; EMMPRIN; EMPRIN; HAb18G; OK; SLC7A11; TCSF
Locus ID 682
UniProt ID P35613
Cytogenetics 19p13.3
Summary The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Write Your Own Review
You're reviewing:CD147 (BSG) (NM_198589) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319418 BSG MS Standard C13 and N15-labeled recombinant protein (NP_940993) 10 ug
$3,255.00
PH319464 BSG MS Standard C13 and N15-labeled recombinant protein (NP_001719) 10 ug
$3,255.00
LC403688 BSG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403695 BSG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419777 BSG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403688 Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 4 100 ug
$436.00
LY403695 Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 2 100 ug
$436.00
LY419777 Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 1 100 ug
$436.00
TP303894 Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2, 20 µg 20 ug
$737.00
TP319418 Purified recombinant protein of Homo sapiens basigin (Ok blood group) (BSG), transcript variant 4, 20 µg 20 ug
$737.00
TP319464 Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 1, 20 µg 20 ug
$737.00
TP720365 Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.