OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DYNLRB2 (NM_130897) Human Mass Spec Standard

Be the first to review this product
SKU
PH319143
DYNLRB2 MS Standard C13 and N15-labeled recombinant protein (NP_570967)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408882 Transient overexpression lysate of dynein, light chain, roadblock-type 2 (DYNLRB2) (as WB positive control) 100 ug
$436.00

Other products for "DYNLRB2 or NM_130897"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219143
Predicted MW 10.7 kDa
Protein Sequence
Protein Sequence
>RC219143 representing NM_130897
Red=Cloning site Green=Tags(s)

MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLR
IRSKKHEIMVAPDKEYLLIVIQNPCE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_570967
RefSeq Size 506
RefSeq ORF 288
Synonyms DNCL2B; DNLC2B; ROBLD2
Locus ID 83657
UniProt ID Q8TF09
Cytogenetics 16q23.2
Summary Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DYNLRB2" proteins (3)
SKU Description Size Price
LC408882 Lyophilized DYNLRB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408882 Transient overexpression lysate of dynein, light chain, roadblock-type 2 (DYNLRB2) (as WB positive control) 100 ug
$436.00
TP319143 Recombinant protein of human dynein, light chain, roadblock-type 2 (DYNLRB2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products