DYNLRB2 (NM_130897) Human Tagged ORF Clone

SKU
RC219143
DYNLRB2 (Myc-DDK-tagged)-Human dynein, light chain, roadblock-type 2 (DYNLRB2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DYNLRB2
Synonyms DNCL2B; DNLC2B; ROBLD2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219143 representing NM_130897
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGGTGGAGGAAACCTTAAAGAGGATCCAGAGTCATAAAGGGGTTATTGGAACTATGGTTGTAA
ATGCAGAAGGTATTCCCATCCGAACAACCTTGGACAACTCAACAACTGTTCAATATGCAGGCCTTCTTCA
TCACCTGACAATGAAAGCCAAAAGCACAGTTCGTGATATTGATCCTCAGAACGACCTGACTTTTCTTAGG
ATCAGATCAAAGAAACATGAAATCATGGTAGCTCCAGATAAGGAATATCTTCTGATCGTCATTCAGAATC
CATGTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219143 representing NM_130897
Red=Cloning site Green=Tags(s)

MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLR
IRSKKHEIMVAPDKEYLLIVIQNPCE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_130897
ORF Size 288 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_130897.3
RefSeq Size 506 bp
RefSeq ORF 291 bp
Locus ID 83657
UniProt ID Q8TF09
Cytogenetics 16q23.2
MW 10.7 kDa
Summary Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DYNLRB2 (NM_130897) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219143L3 Lenti ORF clone of Human dynein, light chain, roadblock-type 2 (DYNLRB2), Myc-DDK-tagged 10 ug
$450.00
RC219143L4 Lenti ORF clone of Human dynein, light chain, roadblock-type 2 (DYNLRB2), mGFP tagged 10 ug
$450.00
RG219143 DYNLRB2 (tGFP-tagged) - Human dynein, light chain, roadblock-type 2 (DYNLRB2) 10 ug
$350.00
SC305925 DYNLRB2 (untagged)-Human dynein, light chain, roadblock-type 2 (DYNLRB2) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.