DYNLRB2 (NM_130897) Human Recombinant Protein

SKU
TP319143
Recombinant protein of human dynein, light chain, roadblock-type 2 (DYNLRB2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219143 representing NM_130897
Red=Cloning site Green=Tags(s)

MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLR
IRSKKHEIMVAPDKEYLLIVIQNPCE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 10.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_570967
Locus ID 83657
UniProt ID Q8TF09
Cytogenetics 16q23.2
RefSeq Size 506
RefSeq ORF 288
Synonyms DNCL2B; DNLC2B; ROBLD2
Summary Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DYNLRB2 (NM_130897) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH319143 DYNLRB2 MS Standard C13 and N15-labeled recombinant protein (NP_570967) 10 ug
$3,255.00
LC408882 DYNLRB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408882 Transient overexpression lysate of dynein, light chain, roadblock-type 2 (DYNLRB2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.