DYNLRB2 (NM_130897) Human Mass Spec Standard

SKU
PH319143
DYNLRB2 MS Standard C13 and N15-labeled recombinant protein (NP_570967)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219143]
Predicted MW 10.7 kDa
Protein Sequence
Protein Sequence
>RC219143 representing NM_130897
Red=Cloning site Green=Tags(s)

MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLR
IRSKKHEIMVAPDKEYLLIVIQNPCE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_570967
RefSeq Size 506
RefSeq ORF 288
Synonyms DNCL2B; DNLC2B; ROBLD2
Locus ID 83657
UniProt ID Q8TF09
Cytogenetics 16q23.2
Summary Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DYNLRB2 (NM_130897) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408882 DYNLRB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408882 Transient overexpression lysate of dynein, light chain, roadblock-type 2 (DYNLRB2) 100 ug
$436.00
TP319143 Recombinant protein of human dynein, light chain, roadblock-type 2 (DYNLRB2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.