CDYL (NM_170752) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC217438] |
Predicted MW | 34.4 kDa |
Protein Sequence |
Protein Sequence
>RC217438 representing NM_170752
Red=Cloning site Green=Tags(s) MDALTANGTTNIQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLST KSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRESTKMAEAIRN FVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASA NEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANER ECEVLKKIWGSAQGTDSMLKYMQRKIDEF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_736608 |
RefSeq Size | 2805 |
RefSeq ORF | 927 |
Synonyms | CDYL1, MGC131936, DKFZp586C1622 |
Locus ID | 9425 |
UniProt ID | Q9Y232 |
Cytogenetics | 6p25.1 |
Summary | Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC406868 | CDYL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406869 | CDYL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406868 | Transient overexpression lysate of chromodomain protein, Y-like (CDYL), transcript variant 2 | 100 ug |
$436.00
|
|
LY406869 | Transient overexpression lysate of chromodomain protein, Y-like (CDYL), transcript variant 3 | 100 ug |
$436.00
|
|
TP317438 | Recombinant protein of human chromodomain protein, Y-like (CDYL), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.