CDYL (NM_170752) Human Recombinant Protein

SKU
TP317438
Recombinant protein of human chromodomain protein, Y-like (CDYL), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217438 representing NM_170752
Red=Cloning site Green=Tags(s)

MDALTANGTTNIQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLST
KSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRESTKMAEAIRN
FVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASA
NEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANER
ECEVLKKIWGSAQGTDSMLKYMQRKIDEF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_736608
Locus ID 9425
UniProt ID Q9Y232
Cytogenetics 6p25.1
RefSeq Size 2805
RefSeq ORF 927
Synonyms CDYL1, MGC131936, DKFZp586C1622
Summary Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CDYL (NM_170752) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317438 CDYL MS Standard C13 and N15-labeled recombinant protein (NP_736608) 10 ug
$3,255.00
LC406868 CDYL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406869 CDYL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406868 Transient overexpression lysate of chromodomain protein, Y-like (CDYL), transcript variant 2 100 ug
$436.00
LY406869 Transient overexpression lysate of chromodomain protein, Y-like (CDYL), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.