CDYL Rabbit Polyclonal Antibody

SKU TA330992

Rabbit polyclonal Anti-CDYL Antibody

Product Data

• Application: IF, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDYL antibody: synthetic peptide directed towards the n terminal of human CDYL. Synthetic peptide located within the following region: YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: chromodomain protein, Y-like
• Database Link:
  NP_004815
  Q9Y232
• Background: CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene.
• Synonyms: CDYL1
• Note: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 79%

Reference Data