OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COMMD5 (NM_001081003) Human Mass Spec Standard

Be the first to review this product
SKU
PH316768
COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074472)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA374980 COMMD5 Rabbit polyclonal Antibody
100 ul
$410.00
LY415491 Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "COMMD5 or NM_001081003"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216768
Predicted MW 24.7 kDa
Protein Sequence
Protein Sequence
>RC216768 protein sequence
Red=Cloning site Green=Tags(s)

MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR
LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS
VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE
MADLEKRCERRLQD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001074472
RefSeq Size 1453
RefSeq ORF 672
Synonyms HCARG; HT002
Locus ID 28991
UniProt ID Q9GZQ3
Cytogenetics 8q24.3
Summary May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis (By similarity). Down-regulates activation of NF-kappa-B (PubMed:15799966).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COMMD5" proteins (11)
SKU Description Size Price
PH301051 COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074473) 10 ug
$3,360.00
PH309381 COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_054785) 10 ug
$3,360.00
LC415491 Lyophilized COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421149 Lyophilized COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421150 Lyophilized COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415491 Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421149 Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421150 Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP301051 Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 3, 20 µg 20 ug
$867.00
TP309381 Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 1, 20 µg 20 ug
$867.00
TP316768 Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products