COMMD5 (NM_001081004) Human Recombinant Protein

SKU
TP301051
Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201051 protein sequence
Red=Cloning site Green=Tags(s)

MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR
LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS
VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE
MADLEKRCERRLQD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001074473
Locus ID 28991
UniProt ID Q9GZQ3
Cytogenetics 8q24.3
RefSeq Size 1321
RefSeq ORF 672
Synonyms HCARG; HT002
Summary May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis (By similarity). Down-regulates activation of NF-kappa-B (PubMed:15799966).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:COMMD5 (NM_001081004) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301051 COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074473) 10 ug
$3,255.00
PH309381 COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_054785) 10 ug
$3,255.00
PH316768 COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074472) 10 ug
$3,255.00
LC415491 COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421149 COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421150 COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415491 Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 1 100 ug
$436.00
LY421149 Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 2 100 ug
$436.00
LY421150 Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 3 100 ug
$436.00
TP309381 Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316768 Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.