COMMD5 (NM_001081004) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201051] |
Predicted MW | 24.7 kDa |
Protein Sequence |
Protein Sequence
>RC201051 protein sequence
Red=Cloning site Green=Tags(s) MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE MADLEKRCERRLQD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001074473 |
RefSeq Size | 1321 |
RefSeq ORF | 672 |
Synonyms | HCARG; HT002 |
Locus ID | 28991 |
UniProt ID | Q9GZQ3 |
Cytogenetics | 8q24.3 |
Summary | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis (By similarity). Down-regulates activation of NF-kappa-B (PubMed:15799966).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH309381 | COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_054785) | 10 ug |
$3,255.00
|
|
PH316768 | COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074472) | 10 ug |
$3,255.00
|
|
LC415491 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421149 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421150 | COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY415491 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 1 | 100 ug |
$436.00
|
|
LY421149 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 2 | 100 ug |
$436.00
|
|
LY421150 | Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 3 | 100 ug |
$436.00
|
|
TP301051 | Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP309381 | Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP316768 | Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.