COMMD5 (NM_001081004) Human Mass Spec Standard

SKU
PH301051
COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074473)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201051]
Predicted MW 24.7 kDa
Protein Sequence
Protein Sequence
>RC201051 protein sequence
Red=Cloning site Green=Tags(s)

MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQR
LGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDS
VAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKE
MADLEKRCERRLQD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001074473
RefSeq Size 1321
RefSeq ORF 672
Synonyms HCARG; HT002
Locus ID 28991
UniProt ID Q9GZQ3
Cytogenetics 8q24.3
Summary May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis (By similarity). Down-regulates activation of NF-kappa-B (PubMed:15799966).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:COMMD5 (NM_001081004) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309381 COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_054785) 10 ug
$3,255.00
PH316768 COMMD5 MS Standard C13 and N15-labeled recombinant protein (NP_001074472) 10 ug
$3,255.00
LC415491 COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421149 COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421150 COMMD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415491 Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 1 100 ug
$436.00
LY421149 Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 2 100 ug
$436.00
LY421150 Transient overexpression lysate of COMM domain containing 5 (COMMD5), transcript variant 3 100 ug
$436.00
TP301051 Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP309381 Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316768 Recombinant protein of human COMM domain containing 5 (COMMD5), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.