B3GALT5 (NM_033171) Human Mass Spec Standard

CAT#: PH314721

B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149361)

Product Images

Coomassie blue staining of purified B3GALT5 protein (Cat# TP314721). The protein was produced from HEK293T cells transfected with B3GALT5 cDNA clone (Cat# RC214721) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214721
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC214721 representing NM_033171
  Red=Cloning site Green=Tags(s)
  
  MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQL
  AERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIE
  WVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRY
  PPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRR
  IVACHFIKPRTLLDYWQALENSRGEDCPPV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_149361
• RefSeq Size: 2871
• RefSeq ORF: 930
• Synonyms: 3-GalTase 5; B3GalT-V; B3GalTx; B3T5; beta-1; beta-3-Gx-T5; beta3Gal-T5; GLCT5
• Locus ID: 10317
• UniProt ID: Q9Y2C3
• Cytogenetics: 21q22.2
• Summary: This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene. [provided by RefSeq, Sep 2017]
• Protein Families: Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways