B3GALT5 (NM_033171) Human Mass Spec Standard
CAT#: PH314721
B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149361)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214721 |
Predicted MW | 36 kDa |
Protein Sequence |
>RC214721 representing NM_033171
Red=Cloning site Green=Tags(s) MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQL AERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIE WVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRY PPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRR IVACHFIKPRTLLDYWQALENSRGEDCPPV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_149361 |
RefSeq Size | 2871 |
RefSeq ORF | 930 |
Synonyms | 3-GalTase 5; B3GalT-V; B3GalTx; B3T5; beta-1; beta-3-Gx-T5; beta3Gal-T5; GLCT5 |
Locus ID | 10317 |
UniProt ID | Q9Y2C3 |
Cytogenetics | 21q22.2 |
Summary | This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene. [provided by RefSeq, Sep 2017] |
Protein Families | Transmembrane |
Protein Pathways | Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409690 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC409691 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC409692 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC409693 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416890 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409690 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2 |
USD 436.00 |
|
LY409691 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 3 |
USD 436.00 |
|
LY409692 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 4 |
USD 436.00 |
|
LY409693 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5 |
USD 436.00 |
|
LY416890 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1 |
USD 436.00 |
|
PH311183 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149363) |
USD 3,255.00 |
|
PH313317 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149362) |
USD 3,255.00 |
|
PH314669 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149360) |
USD 3,255.00 |
|
PH315430 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_006048) |
USD 3,255.00 |
|
TP311183 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5, 20 µg |
USD 867.00 |
|
TP313317 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 4, 20 µg |
USD 867.00 |
|
TP314669 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2, 20 µg |
USD 867.00 |
|
TP314721 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 3, 20 µg |
USD 867.00 |
|
TP315430 | Recombinant protein of human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review