B3GALT5 (NM_033172) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC213317] |
Predicted MW | 36 kDa |
Protein Sequence |
Protein Sequence
>RC213317 representing NM_033172
Red=Cloning site Green=Tags(s) MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQL AERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIE WVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRY PPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRR IVACHFIKPRTLLDYWQALENSRGEDCPPV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_149362 |
RefSeq Size | 2711 |
RefSeq ORF | 930 |
Synonyms | 3-GalTase 5; B3GalT-V; B3GalTx; B3T5; beta-1; beta-3-Gx-T5; beta3Gal-T5; GLCT5 |
Locus ID | 10317 |
UniProt ID | Q9Y2C3 |
Cytogenetics | 21q22.2 |
Summary | This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene. [provided by RefSeq, Sep 2017] |
Protein Families | Transmembrane |
Protein Pathways | Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH311183 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149363) | 10 ug |
$3,255.00
|
|
PH314669 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149360) | 10 ug |
$3,255.00
|
|
PH314721 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149361) | 10 ug |
$3,255.00
|
|
PH315430 | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_006048) | 10 ug |
$3,255.00
|
|
LC409690 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409691 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409692 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC409693 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416890 | B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY409690 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2 | 100 ug |
$436.00
|
|
LY409691 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 3 | 100 ug |
$436.00
|
|
LY409692 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 4 | 100 ug |
$436.00
|
|
LY409693 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5 | 100 ug |
$436.00
|
|
LY416890 | Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1 | 100 ug |
$436.00
|
|
TP311183 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP313317 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP314669 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP314721 | Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP315430 | Recombinant protein of human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.