B3GALT5 (NM_006057) Human Mass Spec Standard

SKU
PH315430
B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_006048)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215430]
Predicted MW 36.2 kDa
Protein Sequence
Protein Sequence
>RC215430 protein sequence
Red=Cloning site Green=Tags(s)

MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQL
AERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIE
WVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRY
PPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRR
IVACHFIKPRTLLDYWQALENSRGEDCPPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006048
RefSeq Size 2786
RefSeq ORF 930
Synonyms 3-GalTase 5; B3GalT-V; B3GalTx; B3T5; beta-1; beta-3-Gx-T5; beta3Gal-T5; GLCT5
Locus ID 10317
UniProt ID Q9Y2C3
Cytogenetics 21q22.2
Summary This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene. [provided by RefSeq, Sep 2017]
Protein Families Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways
Write Your Own Review
You're reviewing:B3GALT5 (NM_006057) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH311183 B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149363) 10 ug
$3,255.00
PH313317 B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149362) 10 ug
$3,255.00
PH314669 B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149360) 10 ug
$3,255.00
PH314721 B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149361) 10 ug
$3,255.00
LC409690 B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409691 B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409692 B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409693 B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416890 B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409690 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2 100 ug
$436.00
LY409691 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 3 100 ug
$436.00
LY409692 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 4 100 ug
$436.00
LY409693 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5 100 ug
$436.00
LY416890 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1 100 ug
$436.00
TP311183 Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP313317 Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314669 Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP314721 Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315430 Recombinant protein of human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.