OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B3GALT5 (NM_006057) Human Mass Spec Standard

Be the first to review this product
SKU
PH315430
B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_006048)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409690 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "B3GALT5 or NM_006057"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215430
Predicted MW 36.2 kDa
Protein Sequence
Protein Sequence
>RC215430 protein sequence
Red=Cloning site Green=Tags(s)

MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQL
AERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIE
WVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRY
PPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRR
IVACHFIKPRTLLDYWQALENSRGEDCPPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006048
RefSeq Size 2786
RefSeq ORF 930
Synonyms 3-GalTase 5; B3GalT-V; B3GalTx; B3T5; beta-1; beta-3-Gx-T5; beta3Gal-T5; GLCT5
Locus ID 10317
UniProt ID Q9Y2C3
Cytogenetics 21q22.2
Summary This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene. provided by RefSeq, Sep 2017
Protein Families Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "B3GALT5" proteins (19)
SKU Description Size Price
PH311183 B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149363) 10 ug
$3,360.00
PH313317 B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149362) 10 ug
$3,360.00
PH314669 B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149360) 10 ug
$3,360.00
PH314721 B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149361) 10 ug
$3,360.00
LC409690 Lyophilized B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409691 Lyophilized B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409692 Lyophilized B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409693 Lyophilized B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416890 Lyophilized B3GALT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409690 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY409691 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY409692 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY409693 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY416890 Transient overexpression lysate of UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP311183 Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 5, 20 µg 20 ug
$867.00
TP313317 Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 4, 20 µg 20 ug
$867.00
TP314669 Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 2, 20 µg 20 ug
$867.00
TP314721 Purified recombinant protein of Homo sapiens UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 3, 20 µg 20 ug
$867.00
TP315430 Recombinant protein of human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products