OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B3GALT5 (NM_006057) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC215430
B3GALT5 (Myc-DDK-tagged)-Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "B3GALT5 or NM_006057"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol B3GALT5
Synonyms 3-GalTase 5; B3GalT-V; B3GalTx; B3T5; beta-1; beta-3-Gx-T5; beta3Gal-T5; GLCT5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215430 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTTCCCGAAGATGAGATTGATGTATATTTGCCTTCTGGTTCTGGGGGCTCTTTGTTTGTATTTTA
GCATGTACAGTCTAAATCCTTTCAAAGAACAGTCCTTTGTTTACAAGAAAGACGGGAACTTCCTTAAGCT
CCCAGATACAGACTGCAGGCAGACACCTCCCTTCCTCGTCCTGCTGGTGACCTCATCCCACAAACAGTTG
GCTGAGCGCATGGCCATCCGGCAGACGTGGGGGAAAGAGAGGACGGTGAAGGGAAAGCAGCTGAAGACAT
TCTTCCTCCTGGGGACCACCAGCAGTGCAGCGGAAACAAAAGAGGTGGACCAGGAGAGCCAGCGACACGG
GGACATTATCCAGAAGGATTTCCTAGACGTCTATTACAATCTGACCCTGAAGACCATGATGGGCATAGAA
TGGGTCCATCGCTTTTGTCCTCAGGCGGCGTTTGTGATGAAAACAGACTCAGACATGTTCATCAATGTTG
ACTATCTGACTGAACTGCTTCTGAAGAAAAACAGAACAACCAGGTTTTTCACTGGCTTCTTGAAACTCAA
TGAGTTTCCCATCAGGCAGCCATTCAGCAAGTGGTTTGTCAGTAAATCTGAATATCCGTGGGACAGGTAC
CCACCATTCTGCTCCGGCACCGGCTACGTGTTTTCTGGCGACGTGGCGAGTCAGGTGTACAATGTCTCCA
AGAGCGTCCCATACATTAAACTGGAAGACGTGTTTGTGGGGCTCTGCCTCGAAAGGCTGAACATCAGATT
GGAGGAGCTCCACTCCCAGCCGACCTTTTTTCCAGGGGGCTTACGCTTCTCCGTATGCCTCTTCAGGAGG
ATCGTGGCCTGCCACTTCATCAAGCCTCGGACTCTCTTGGACTACTGGCAGGCTCTAGAGAATTCCCGGG
GGGAAGATTGTCCGCCTGTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC215430 protein sequence
Red=Cloning site Green=Tags(s)

MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQL
AERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIE
WVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRY
PPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRR
IVACHFIKPRTLLDYWQALENSRGEDCPPV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006057
ORF Size 930 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006057.3
RefSeq Size 2786 bp
RefSeq ORF 933 bp
Locus ID 10317
UniProt ID Q9Y2C3
Cytogenetics 21q22.2
Protein Families Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways
MW 36.2 kDa
Summary This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene. provided by RefSeq, Sep 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006057" in other vectors (4)
SKU Description Size Price
RC215430L3 Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC215430L4 Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1, mGFP tagged 10 ug
$600.00
RG215430 B3GALT5 (tGFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1 10 ug
$489.00 $500.00
SC303726 B3GALT5 (untagged)-Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3GALT5), transcript variant 1 10 ug
$330.00

Plasmid Map for RC215430

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC215430
Circular map for RC215430

file-alt Citations

High B3GALT5 expression confers poor clinical outcome and contributes to tumor progression and metastasis in breast cancer
Liao, Wang, Hung et al
Breast Cancer Res (2021) 23 (1), 5 DOI: 10.1186/s13058-020-01381-9
Cited by 30
AI Summary: OriGene’s B3GALT5 (NM_006057) Human Tagged ORF Clone was used to construct plasmids for overexpression studies, enabling the researchers to investigate the functional role of B3GALT5 in breast cancer progression and metastasis.
Snippet: For plasmid construction, full-length coding sequences of human B3GALT5 from B3GALT5 (NM_006057) Human Tagged ORF Clone (Origene, MD, USA) were cloned with pLenti6/V5 Directional TOPO Cloning Kit (ThermoFisher, CA, USA) according to the manufacturer's
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products