OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cardiac Troponin T (TNNT2) (NM_000364) Human Mass Spec Standard

Be the first to review this product
SKU
PH314180
TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_000355)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY400130 Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Cardiac Troponin T or NM_000364"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214180
Predicted MW 35.4 kDa
Protein Sequence
Protein Sequence
>RC214180 representing NM_000364
Red=Cloning site Green=Tags(s)

MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPM
EESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERR
RAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKTERKSGKRQT
EREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQK
VSKTRGKAKVTGRWK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000355
RefSeq Size 1153
RefSeq ORF 885
Synonyms CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Locus ID 7139
UniProt ID P45379
Cytogenetics 1q32.1
Summary The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Cardiac Troponin T" proteins (16)
SKU Description Size Price
PH301218 TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_001001431) 10 ug
$3,360.00
PH314241 TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_001001430) 10 ug
$3,360.00
PH314299 TNNT2 MS Standard C13 and N15-labeled recombinant protein (NP_001001432) 10 ug
$3,360.00
LC400130 Lyophilized TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424349 Lyophilized TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424350 Lyophilized TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424351 Lyophilized TNNT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400130 Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424349 Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424350 Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY424351 Transient overexpression lysate of troponin T type 2 (cardiac) (TNNT2), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP301218 Recombinant protein of human troponin T type 2 (cardiac) (TNNT2), transcript variant 3, 20 µg 20 ug
$867.00
TP314180 Recombinant protein of human troponin T type 2 (cardiac) (TNNT2), transcript variant 1, 20 µg 20 ug
$867.00
TP314241 Purified recombinant protein of Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 2, 20 µg 20 ug
$867.00
TP314299 Purified recombinant protein of Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 4, 20 µg 20 ug
$867.00
TP750172 Purified recombinant protein of Human troponin T type 2 (cardiac) (TNNT2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50 ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products