Cardiac Troponin T (TNNT2) (NM_000364) Human Tagged ORF Clone

SKU
RC214180
TNNT2 (Myc-DDK-tagged)-Human troponin T type 2 (cardiac) (TNNT2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cardiac Troponin T
Synonyms CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC214180 representing NM_000364
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGACATAGAAGAGGTGGTGGAAGAGTACGAGGAGGAGGAGCAGGAAGAAGCAGCTGTTGAAGAAG
AGGAGGACTGGAGAGAGGACGAAGACGAGCAGGAGGAGGCAGCGGAAGAGGATGCTGAAGCAGAGGCTGA
GACCGAGGAGACCAGGGCAGAAGAAGATGAAGAAGAAGAGGAAGCAAAGGAGGCTGAAGATGGCCCAATG
GAGGAGTCCAAACCAAAGCCCAGGTCGTTCATGCCCAACTTGGTGCCTCCCAAGATCCCCGATGGAGAGA
GAGTGGACTTTGATGACATCCACCGGAAGCGCATGGAGAAGGACCTGAATGAGTTGCAGGCGCTGATTGA
GGCTCACTTTGAGAACAGGAAGAAAGAGGAGGAGGAGCTCGTTTCTCTCAAAGACAGGATCGAGAGACGT
CGGGCAGAGCGGGCCGAGCAGCAGCGCATCCGGAATGAGCGGGAGAAGGAGCGGCAGAACCGCCTGGCTG
AAGAGAGGGCTCGACGAGAGGAGGAGGAGAACAGGAGGAAGGCTGAGGATGAGGCCCGGAAGAAGAAGGC
TTTGTCCAACATGATGCATTTTGGGGGTTACATCCAGAAGACAGAGCGGAAAAGTGGGAAGAGGCAGACT
GAGCGGGAAAAGAAGAAGAAGATTCTGGCTGAGAGGAGGAAGGTGCTGGCCATTGACCACCTGAATGAAG
ATCAGCTGAGGGAGAAGGCCAAGGAGCTGTGGCAGAGCATCTATAACTTGGAGGCAGAGAAGTTCGACCT
GCAGGAGAAGTTCAAGCAGCAGAAATATGAGATCAATGTTCTCCGAAACAGGATCAACGATAACCAGAAA
GTCTCCAAGACCCGCGGGAAGGCTAAAGTCACCGGGCGCTGGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214180 representing NM_000364
Red=Cloning site Green=Tags(s)

MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPM
EESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERR
RAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKTERKSGKRQT
EREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQK
VSKTRGKAKVTGRWK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000364
ORF Size 885 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000364.4
RefSeq Size 1153 bp
RefSeq ORF 888 bp
Locus ID 7139
UniProt ID P45379
Cytogenetics 1q32.1
Domains Troponin
Protein Families Druggable Genome
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)
MW 35.4 kDa
Summary The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Cardiac Troponin T (TNNT2) (NM_000364) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214180L3 Lenti ORF clone of Human troponin T type 2 (cardiac) (TNNT2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC214180L4 Lenti ORF clone of Human troponin T type 2 (cardiac) (TNNT2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG214180 TNNT2 (tGFP-tagged) - Human troponin T type 2 (cardiac) (TNNT2), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119932 TNNT2 (untagged)-Human troponin T type 2 (cardiac) (TNNT2), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.