OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SAR1B (NM_001033503) Human Mass Spec Standard

Be the first to review this product
SKU
PH313692
SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_001028675)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349246 Rabbit Polyclonal Anti-SAR1B Antibody
100 ul
$205.00
LY402500 Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SAR1B or NM_001033503"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213692
Predicted MW 22.4 kDa
Protein Sequence
Protein Sequence
>RC213692 protein sequence
Red=Cloning site Green=Tags(s)

MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
FTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPE
AISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001028675
RefSeq Size 6651
RefSeq ORF 594
Synonyms ANDD; CMRD; GTBPB; SARA2
Locus ID 51128
UniProt ID Q9Y6B6
Cytogenetics 5q31.1
Summary The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is part of the COPII coat complex. Defects in this gene are a cause of chylomicron retention disease (CMRD), also known as Anderson disease (ANDD). Two transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Mar 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SAR1B" proteins (7)
SKU Description Size Price
PH310593 SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_057187) 10 ug
$3,360.00
LC402500 Lyophilized SAR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422370 Lyophilized SAR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402500 Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422370 Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310593 Recombinant protein of human SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2, 20 µg 20 ug
$867.00
TP313692 Recombinant protein of human SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products